Please help asap!!!

[BEEBOA]

I am creating a database of possible protein sequences for a research project that I am working on. I need a way to do this type of formatting for my sequences and cant figure out a way to be able to delete one letter from the right hand side with each new cell:

[TABLE="width: 469"]
<colgroup><col></colgroup><tbody>[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTHR[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTH[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVT[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCV[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATC[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTAT[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNTA[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACNT[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFACN[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFAC[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAFA[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKAF[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSKA[/TD]
[/TR]
[TR]
[TD]LAGLLSRSGGMVKSNFVPTNVGSK

I have been doing this by hand for one of my proteins of 37 character length, but absolutely cannot do this for more hours with my next 82 character long protein. Any suggestions are helpful! Thank you!!![/TD]
[/TR]
</tbody>[/TABLE]

 

[Norie]

If you have LAGLLSRSGGMVKSNFVPTNVGSKAFACNTATCVTHR in A1 put this in A2 and copy down.

=LEFT(A1,LEN(A1)-1)

 

[BEEBOA]

You just saved me hours!!!!

THANK YOU SO MUCH!!